PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02454.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 326aa    MW: 35908.3 Da    PI: 8.721
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02454.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.66.7e-191764148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WTt+Ed+ll++ v+q+G g+W+++ ++ g++R++k+c++rw +yl
  Zmw_sc02454.1.g00040.1.am.mk 17 KGPWTTQEDKLLIEHVRQHGEGRWNSVCKHTGLKRSGKSCRLRWVNYL 64
                                  79********************************************97 PP

2Myb_DNA-binding54.13.7e-1770114147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  Zmw_sc02454.1.g00040.1.am.mk  70 RGKITPQEERIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114
                                   8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0151264IPR017930Myb domain
SuperFamilySSF466894.03E-2915111IPR009057Homeodomain-like
SMARTSM007172.3E-161666IPR001005SANT/Myb domain
PfamPF002498.7E-181764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-231871IPR009057Homeodomain-like
CDDcd001672.83E-121964No hitNo description
PROSITE profilePS5129426.06365119IPR017930Myb domain
SMARTSM007172.8E-1669117IPR001005SANT/Myb domain
PfamPF002498.5E-1570114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2472117IPR009057Homeodomain-like
CDDcd001675.39E-1174115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MEGQLSWGRQ EVDGWRKGPW TTQEDKLLIE HVRQHGEGRW NSVCKHTGLK RSGKSCRLRW  60
VNYLRPDLKR GKITPQEERI IVQLHALWGN RWSTIARSLP GRTDNEIKNY WRTHFKKGKP  120
SKNIEIARAR FLKQRREMQC PQRQQQVQLV NKNEDTELHA TRTAGTVKVD ADRGSAVVDN  180
ACPATTTAAA ADQSGHQQAA DLIIHDVIMD FMCPMSCSLL LHGAGAHQGA AGAGSCCGST  240
SEEYGSSEED GATWGSLWNL EDIVVDGGGG ACSLWWGRGE RSTARGVKHP SAHQLDPVAA  300
VVLVDNDGTT TAVRPLCSSR GGSRLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-281711727126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.11e-119PREDICTED: transcription repressor MYB6-like
TrEMBLK3Y9D01e-119K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-119(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584